DPCstruct | MC9042
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 166 ± 16 aa |
| Standard deviation of domain lengths | 15.79 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 31.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S7GRL5 | 1-146 | MGTGQFLCDFRRDYHITKSLAHRKAVTQTKQKANEKWMKVHFQHIEQDRSPGKKVSHVRLLLLVNELKDNGLTCLCTKNELQRLCNG… |
| A0A6S7IBM0 | 68-251 | LSQQGPDLIKDSIEDVTKNEVLQTKFLNLFCLDDNGDKAMVLELYREVVIRYLKMGAGQFLRDFRKDYQLQKTFAHRKSLMQKKEKA… |
| A0A8B6CPM9 | 1-176 | None |
| K1PGA8 | 6-171 | None |
| A0A7D9LAM5 | 527-704 | None |
| A0A7D9D5F5 | 168-310 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.