DPCstruct | MC9041
Metacluster Properties and Pfam Annotations
| Number of structural domains | 42 |
|---|---|
| Mean domain length (aa) | 404 ± 84 aa |
| Standard deviation of domain lengths | 83.97 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 18.14 |
| Pfam Score | 81.77 |
| Assigned Pfam label(s) | PF02617- PF02207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2MKL1 | 1-426 | MKPLLALCFENIDQNTKGLICSKAGGLGRCDRLLQPETKSYLCTDCASDASGRLCEECFLNSTHVEHNYVLAAETPQSLCHCGNTEV… |
| A0A6J8ALU5 | 69-451 | DEFSKNVRRYDNAVICGLVWTANFVAYRCRTCGISPCMSLCADCFQAGNHEGHDFNMFRSQAGGACDCGDVSVMKKEGFCTRHGPDR… |
| A0A813US08 | 130-434 | None |
| E9FUZ5 | 1-320 | None |
| A0A0V0R1V4 | 135-493 | None |
| A0A0C2I9P7 | 1-503 | None |
| A0A0C2J6Z1 | 1-500 | None |
| A0A2W1BLZ8 | 8-518 | None |
| A0A2W1BT50 | 12-379 | None |
| A0A6J3C282 | 27-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.