DPCstruct | MC9040
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 400 ± 94 aa |
| Standard deviation of domain lengths | 93.72 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 75.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 31.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8ALQ0 | 10-377 | TESEASTQTTNIDSSLINSFIDACDALKKINRYEDFVSVLKGIGGFKAEGLAQEYVTPTDCRINFAVPSNPILTKESAKFSTDADKP… |
| A0A6J8AI92 | 19-411 | GEVLSLMPTVLKNVQKAGHLADFINLLKLISVDKFPLNNISFLLLLEVARWYSLENTTKMFYSDQCMRFWKVLYRLFHGKALRFMQE… |
| A0A6J8EN15 | 1-318 | None |
| A0A8B6FCT8 | 50-470 | None |
| A0A8B6F3A4 | 28-601 | None |
| A0A8B6DBR9 | 339-768 | None |
| A0A8B6CY15 | 53-431 | None |
| A0A6J8DP60 | 1-306 | None |
| A0A8B6DAD6 | 100-555 | None |
| A0A8B6H0M3 | 100-555 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.