DPCstruct | MC904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 116 ± 18 aa |
| Standard deviation of domain lengths | 17.79 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 26.26 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3YD09 | 8-121 | CTRVSREIESELERVFLEQQWTPSEGLRNILLEWLAVQRFPQIEFRETRAGRRAALRGGPEVWEIAAAAGPGRAMSAAVGQRFAGTR… |
| A0A838J7Y7 | 2-119 | PQVISLRIPDATAERLRTTARRAGRTLNEWGALSLEEWLRQNEFADIEFRSVGGERQACLKGALPIWQIILVAQSYGMDTERTAEHF… |
| A0A7W1MZH0 | 8-123 | None |
| A0A023X4Z4 | 12-127 | None |
| A0A2V8J399 | 2-104 | None |
| A0A2N2PQN0 | 25-137 | None |
| X1RY08 | 79-197 | None |
| A0A832AM81 | 6-119 | None |
| A0A7W0JJ54 | 2-114 | None |
| A0A543C677 | 44-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.