DPCstruct | MC9039
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 160 ± 15 aa |
| Standard deviation of domain lengths | 15.45 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 28.88 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A402G8R8 | 1-174 | VRKETELLMKPYANWEEYLMPGPISIAILGELACISAGQGDFSINKNPPAGGFEYIRYPDSFLTCLMQVSNKGWEAFSTAHNNMNKI… |
| A0A0L0SAD2 | 9-169 | SEIAKIAHREAMEHMTRSPWEQRIGSAPMVIAAMGLLRCLVVGNDFSISDSIPVRGWQYVRWPGSFYATMSQITHETASAFTLAETN… |
| A0A7M5VF38 | 16-170 | None |
| A0A822F9X8 | 8-169 | None |
| A0A820UXY7 | 51-216 | None |
| E9G596 | 78-249 | None |
| A0A816Z3S9 | 2-127 | None |
| A0A8B6G3W0 | 1-179 | None |
| E9G595 | 2-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.