DPCstruct | MC9038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 330 |
|---|---|
| Mean domain length (aa) | 216 ± 41 aa |
| Standard deviation of domain lengths | 41.41 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 21.96 |
| Pfam Score | 99.47 |
| Assigned Pfam label(s) | PF18052- PF11105- PF00194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J8JJ20 | 9-214 | PGTEPLDLHNNGHTVQLSLPSTLYLGGLPRKYVAAQLHLHWGQKGSPGGSEHQINSEATVAELHIVHYDSDSYDSLSEAAEKPQGLA… |
| A0A6J8AKS1 | 6-222 | QSPIDIKTDNVKFDPRLRKFNFFDLILHRDVKVKIQNNGHTGDRGWITGTYIVEQFHFHWGSVDTRGSEHEINGKHFAMEMHVVMHS… |
| A0A6S7GDQ5 | 258-512 | None |
| A0A1D2NDH0 | 176-435 | None |
| A0A254T6N0 | 181-358 | None |
| A0A7R9KPF8 | 3-180 | None |
| A0A7R9KD29 | 150-331 | None |
| A0A3Q7SDT8 | 68-307 | None |
| A0A2B4S7Z8 | 104-298 | None |
| A0A7S2XUJ3 | 1-287 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.