DPCstruct | MC9037
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 160 ± 30 aa |
| Standard deviation of domain lengths | 29.94 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 78.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.37 |
| Pfam Score | 80.00 |
| Assigned Pfam label(s) | CL0083- PF19002 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8AK40 | 2-166 | ENTSWIVFSLIFTFVSCSTITRFKDPLPMCDENIVCSKINALSYLTEERHYFSYVTCQCPSGQKCPKAPGKQTILVEEGLWYGLCTP… |
| A0A6A4X4I2 | 9-130 | RAVCRPAAVCAVVQANAWGVSRQQLCRCPGRQRCPLHWDNEDGHSVTHGSSQYKAPALAPCAEGQPAMTDELVTYLDPGTPMEHHEQ… |
| A0A7R9L1D6 | 2-154 | None |
| A0A7R9KXK1 | 80-249 | None |
| A0A1D2NKP6 | 1-176 | None |
| A0A2R7WGG9 | 38-158 | None |
| D5KXH3 | 1-137 | None |
| A0A164ZC47 | 3-128 | None |
| R7U7Q8 | 22-197 | None |
| A0A4C1ZIU4 | 263-430 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.