DPCstruct | MC9036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 154 ± 12 aa |
| Standard deviation of domain lengths | 12.22 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 78.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 22.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8A7U7 | 23-162 | KETRTRTLTEKAQIEYDKTVTNYLSKLSILKRNVDYEIGTYKSEDQTKESISVCQKRIENSLDKYLNMAEEISQYLKRKNTADSLQE… |
| A0A6J8AJP9 | 58-216 | TSTSVDETDIDAPRLRTLTEAGVSLYEKRKEKHLARIAKSWDNVEIIIDSVGSLPDEIKSVKEAEADFYEFVDNYETLSENYTDFLT… |
| A0A6J8DZA2 | 1-155 | None |
| A0A6J8B1K8 | 17-185 | None |
| A0A6J8F099 | 59-237 | None |
| A0A6J8AM51 | 545-682 | None |
| K1PZF1 | 1-149 | None |
| A0A6J8BWR2 | 10-158 | None |
| A0A6J8BW95 | 51-195 | None |
| K1QRR0 | 4-163 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.