DPCstruct | MC9035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 76 ± 2 aa |
| Standard deviation of domain lengths | 1.73 |
| Length coefficient of variation | 0.02 |
| Mean AlphaFold2 pLDDT confidence score | 84.50 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 99.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J8DGX5 | 91-167 | LSELAFSGRHAEQSVWVISQRYNSVLKDLREQTKWLCMFYTKDRDSFDNCLRENDVIPTLEERQRIKEELKKKKHRK |
| A0A6J8BRS9 | 225-299 | LSELAFSGRHAEQSVWVISQRYNSVLKDLREQTKWLCMFYTKDRDSFDNCLRENDVIPTLEERQRIKEELKKKKH |
| A0A6J8ET89 | 169-241 | None |
| A0A8B6C3V0 | 494-570 | None |
| A0A8B6HSY0 | 660-737 | None |
| A0A8B6FPB0 | 347-423 | None |
| A0A6J8BQU8 | 221-294 | None |
| A0A6J8DCT6 | 275-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.