DPCstruct | MC9034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 181 |
|---|---|
| Mean domain length (aa) | 201 ± 37 aa |
| Standard deviation of domain lengths | 36.63 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 78.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 18.37 |
| Pfam Score | 98.57 |
| Assigned Pfam label(s) | CL0023- CL0291- CL0422- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3M6UPJ7 | 5-178 | LDSSEEKTNGTKLLRLAIDGGTTVLRNYLMRSIIPSTLQDVLLNHMGRLYHLKSSKKIITSDQWNQLFPSTSVPPNPQTFDITLLHL… |
| A0A6J8ADB4 | 3-207 | SLSKEEENYVRLALLLKGVTPRAVRTYFDREFPPISLPSTLSTSHNTLLDLKKGRIINQAQWNLLIPRNDVIGVSDSKTFDVTLMIC… |
| A0A1S3IYI1 | 203-441 | None |
| A0A1S3J380 | 21-274 | None |
| A0A1S3JDH5 | 218-448 | None |
| A0A8B6ENI2 | 17-217 | None |
| A0A8B6ENT5 | 7-205 | None |
| A0A8B6EQC8 | 1-192 | None |
| A0A8B6ETX5 | 1-267 | None |
| A0A8B6EVE5 | 10-209 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.