DPCstruct | MC9033
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 174 ± 23 aa |
| Standard deviation of domain lengths | 22.82 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 21.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A832H8I2 | 38-197 | LGINLNGPADFNTELPFVDVFRLSRKWISQREGAGWGKGPALDLDEKGWVRRLEPGCFAETPVLTVPGGRYPGGIYTVLYEGEGKLR… |
| A0A6J8ABK6 | 5-177 | DVSVGMNLGGLSYYSSELKFVDIAKFSQSWITQRTSGPNANKWDTNEQNLVNWRNDGYPAFLPDNMRLGKLKLRSTIGLYAPKGNYT… |
| A0A5C7PZW6 | 4-177 | None |
| A0A401ZXJ6 | 48-230 | None |
| A0A3D9HRU4 | 9-178 | None |
| A0A418RNI9 | 715-890 | None |
| K9YXE2 | 65-264 | None |
| A0A843YB73 | 1-142 | None |
| A0A7X4YPS5 | 299-457 | None |
| A0A7Y4WH51 | 21-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.