DPCstruct | MC9031
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 466 ± 64 aa |
| Standard deviation of domain lengths | 64.25 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 77.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 23.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A673XSN5 | 374-865 | SPGVKKEKQKDNKSDDSETKGQDVPPPKRIPSGKKQVSASERLTIYFHAVLSKDFKLNPDEDRIFIRAGGNIGNWDTNSVELTMSKD… |
| A0A6J8A8D2 | 3-382 | AYSYAGGHHRPTRGPVTTDSLMPNIPENKTMDVTFHVALSKKKWDTPQGKSLMLIVTNEDEEIAGHTLRMTDETDSKYLEFATSFTI… |
| A0A6F9A6J3 | 264-718 | None |
| G1P6E6 | 4-478 | None |
| A0A1X7SSP8 | 1-520 | None |
| A0A498NC98 | 354-900 | None |
| A0A7J6D7G4 | 146-529 | None |
| A0A6G0HVM2 | 381-873 | None |
| A0A6J8BCT4 | 68-542 | None |
| A0A1S3WVJ2 | 1-552 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.