DPCstruct | MC9030
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 204 ± 20 aa |
| Standard deviation of domain lengths | 20.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 77.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 36.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A8B6F3A4 | 116-349 | DKLQELIALAPAVLTVLNQNNCADSIVKFFKVVSEGKFPLDNIAFLLWIELVNFFSTSNTCEMRYMDSTKKFWKLGWILFGSKFIRF… |
| A0A6J8A8B3 | 2-176 | ALQYLHENNQLAVWFILFKCLANRTFPLDNIAYNLFLDVVNWFSCDDACGMRYSDTVKRFWRTGKQLFKGKFLRFMSGLKHFGQVLF… |
| A0A8B6CY15 | 43-236 | None |
| A0A8B6DAD6 | 148-344 | None |
| A0A8B6CY32 | 175-378 | None |
| A0A6J8BFU0 | 1-181 | None |
| A0A8B6FCT8 | 77-276 | None |
| A0A8B6H0M3 | 149-364 | None |
| A0A8B6GX70 | 50-285 | None |
| A0A6J8AI92 | 1-226 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.