DPCstruct | MC903
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 252 ± 24 aa |
| Standard deviation of domain lengths | 24.46 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.36 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 26.79 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0203- CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5S9MB98 | 3-246 | GDNPLNRSYVVGFGQNPPKHPHHRTAHGSWSNQLTNPPSHRHTLYGALVGGPNAQDQYDDDISDYISNEVATDYNAAFTGNIAKMVQ… |
| A0A838EVB2 | 47-318 | DFADWARGQMDYIMGKNPLNRSYIVGFGANAASRPHHRAAHGSFNDNLFDPIDHHHILWGGLVGGPDPQDHHTDAIDDFIYNEVAID… |
| W4VBC0 | 164-427 | None |
| A0A0A9VJR1 | 45-291 | None |
| A0A565BE62 | 1-225 | None |
| R6ZZ89 | 305-540 | None |
| A0A1B6Q0Y5 | 247-543 | None |
| A0A7U3NY73 | 2-223 | None |
| A0A5B7D6F9 | 48-328 | None |
| A0A2U1PDB4 | 99-315 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.