DPCstruct | MC9029
Metacluster Properties and Pfam Annotations
| Number of structural domains | 125 |
|---|---|
| Mean domain length (aa) | 171 ± 21 aa |
| Standard deviation of domain lengths | 20.86 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 82.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.44 |
| Mean intra-cluster sequence similarity (%) | 14.34 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14704 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W8FCR5 | 193-380 | VPPGANWSMLSPDHTDFVASRRMRALPDWDSGARKAACPDGQRLLGLSHTGNRGLCSDVIAGPLGDPSGGHEVVRGERHVTPGADWA… |
| A0A6J8A898 | 25-186 | ISILTVVGIKYGSAWKNQFDQLLHFDCPDGQGIYQIKGTHSTGHKDRRFDFKCRSVGGQQNCAYTGFVNNFDRTFAFQCPRNTYIAG… |
| A0A7W3R5B3 | 14-206 | None |
| A0A4Q6F9A7 | 133-317 | None |
| A0A5S6Q4A8 | 17-182 | None |
| A0A5S6Q4B4 | 21-182 | None |
| A0A0D8XIS1 | 533-707 | None |
| A0A0D8XKC9 | 1-153 | None |
| A0A3B4V1B2 | 15-175 | None |
| A0A0N4W781 | 1-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.