DPCstruct | MC9028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 195 ± 17 aa |
| Standard deviation of domain lengths | 17.12 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 68.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 40.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10574 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2P6NNP0 | 17-197 | RDYHQGNGIIGIGQLVGERFQTVISKSDISRYHALIIKITKAFKVELNKYNNPIAPNFKSDVGKLTDQEIAVILSGREAGNTGPAPK… |
| A0A6J8A816 | 11-221 | SNLTLITIEHSEWNVEEKSGGTGVLIEGNVCRRSKVSVNTKDGNKKRYFVLHVDVQKAHKRKFDSSGKEINPNFSETQKIGTGYLNK… |
| A0A1X7TP65 | 18-220 | None |
| A0A498MAU7 | 130-328 | None |
| S4RAX3 | 1-196 | None |
| A0A1X7TNX2 | 18-228 | None |
| A0A2U3ZDL5 | 10-225 | None |
| A0A3Q7QSS7 | 118-312 | None |
| A0A0L8FFN3 | 5-185 | None |
| A0A3B3WZT4 | 250-450 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.