DPCstruct | MC9027
Metacluster Properties and Pfam Annotations
| Number of structural domains | 346 |
|---|---|
| Mean domain length (aa) | 204 ± 41 aa |
| Standard deviation of domain lengths | 41.33 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 80.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.42 |
| Pfam Score | 96.08 |
| Assigned Pfam label(s) | CL0023- CL0194 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| J9H6W7 | 2-158 | AANPVKQSRMPYLDEGIVKYALLEPEHAEAQYLPAGAFITSYARQFTIRAAQANYERWLYCDTDSVYLRGTEPPVDMRVDAYELGAW… |
| A0A6J8A6S9 | 3-227 | NSFYGKTLEDIRGRSEIKLLTDREEVKKYIKKQNFKDSTIFNDNFVAIENNVTSVKFNKPIYLGQAILDYSKQLMYDFYYNVVNKLW… |
| A0A6S7IKQ3 | 174-345 | None |
| A0A5J4VIQ9 | 5-268 | None |
| A0A6S7IE47 | 349-541 | None |
| A0A6S7I3B4 | 620-843 | None |
| A0A5J4VT83 | 2-181 | None |
| A0A5J4VR91 | 296-527 | None |
| A0A5J4VPV6 | 2-225 | None |
| A0A5J4VM00 | 600-819 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.