DPCstruct | MC9025
Metacluster Properties and Pfam Annotations
| Number of structural domains | 47 |
|---|---|
| Mean domain length (aa) | 176 ± 28 aa |
| Standard deviation of domain lengths | 28.42 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 81.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 37.65 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0059 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7JRG9 | 451-623 | IKGLLMKNGINVETVADIHPIHVQPSRVLSHIYARLGRNPRLGLTGRPYRRIGVLGTSKFYIIRNTIFAFTPQFIDHQQFYLALDNK… |
| A0A6J8A2T4 | 5-178 | LEEHGISVQTVSQVHPIHVYPARVLTQIYSLLGKNKKLGLTGRPSSEVGLLATSKLYVMNEQMLAFIPQFVDETQFYLPCDIDLRCD… |
| A0A1I8ILZ9 | 170-331 | None |
| A0A814TIM8 | 107-271 | None |
| A0A7R9Q136 | 20-208 | None |
| A0A2D0QID2 | 2-184 | None |
| A0A067RWI8 | 450-668 | None |
| A0A183MU10 | 131-348 | None |
| A0A182K421 | 27-189 | None |
| T1GV73 | 184-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.