DPCstruct | MC9023
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Standard deviation of domain lengths | 15.09 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 74.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 25.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9H9P8 | 187-319 | SIKVTETPSAHTKRPNETKALSISPEESGIIDVSFPILTGMFGRAATLVNNPSYIWKMPTTDTQDKPAFMVHSTSSDNPHRVMVCPK… |
| A0A6J7ZW69 | 1-162 | MFLRNFKKQNLKSRHQEEDEGMFINDTEHCGALTVMADESGITSVPFPKLKGIFEKAATLYHSRADIVSFPGKPRASNIVSKYFITS… |
| A0A6S7HG45 | 340-488 | None |
| A0A8B6H921 | 330-450 | None |
| A0A6S7HQW9 | 429-538 | None |
| A0A2B4RAH3 | 30-164 | None |
| A0A6P8HKW6 | 430-558 | None |
| A0A7D9ID80 | 793-933 | None |
| A0A6J8BE64 | 1-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.