DPCstruct | MC902
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 70 ± 7 aa |
| Standard deviation of domain lengths | 7.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 92.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.53 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R5A0Y2 | 40-109 | TSLIVNDFCGGKIMKCMTPYGSHYYNLINNEVIDLTVEQFNGYIPDYKTGEERTREYLLSNNDTKNRYYE |
| A0A150MNX5 | 2-62 | VNDLFGGEIIKTTTPEGWHFYNKINGQRYDLTESQFPEAIEYMDIPSNREEAFSDTNERQY |
| A0A1N7AGU0 | 48-113 | None |
| A0A2G6HY69 | 40-122 | None |
| A0A6I7T071 | 1-66 | None |
| E0R9F5 | 4-69 | None |
| I2C9T5 | 2-80 | None |
| A0A1T5EYQ6 | 102-171 | None |
| A0A2A4Z7N0 | 38-117 | None |
| A0A1G6UHT7 | 35-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.