DPCstruct | MC9019
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 185 ± 45 aa |
| Standard deviation of domain lengths | 45.48 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 80.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 41.59 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2D4EVA2 | 4-144 | LVVGNLVNWSFAIFGLVYRPRDFASYMLGIFICNLLLYLAFYVIMKLRSSEKLLPFPLFCIVATAVVWAAALYFFFQNPSSWEETPA… |
| A0A7F5RHP7 | 46-220 | DKGMVRRRFQIIANDFRSGPLNILKPLHRGRMVLLILGNIVNWLLAGYGLYKHEKDFALYLLAILLCNTMLYFLFYLVMKVLHKEKI… |
| A0A3R7N218 | 503-730 | None |
| A0A1I8IUT2 | 148-303 | None |
| A0A2W1BSL8 | 360-603 | None |
| A0A5K4FAZ5 | 731-956 | None |
| A0A0M3ILL4 | 72-239 | None |
| A0A1I7Y400 | 325-533 | None |
| A0A7R9D593 | 419-550 | None |
| A0A6P9B6X6 | 348-593 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.