DPCstruct | MC9018
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 12.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 38.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7UVH4 | 19-141 | IQNCPINAYIFDCLNGCMCNTDESAVHCHSLNLESLEVPKSKLRGFDVIGLTNNKIKNLPTESELLGKFPDLKAVDLEGNRNFDCSS… |
| A0A0C2G9K9 | 1-119 | MLGTPQRYVFDCLDNCECDTEDEVVHCHNGDRTELALPHGQRLRGFPVIGLTYNNIVRLPDEATLLSKFPDLKVIDVERNPNFDCDS… |
| A0A0N5D966 | 60-201 | None |
| A0A0N4U6Y4 | 38-159 | None |
| A0A090LGF9 | 2-104 | None |
| A0A0N4ZKP1 | 1-152 | None |
| A0A3P7LIV2 | 13-155 | None |
| A0A498S4V0 | 1-132 | None |
| A0A3P6IG88 | 5-128 | None |
| A0A7E4ULF9 | 14-151 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.