DPCstruct | MC9016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 86 ± 9 aa |
| Standard deviation of domain lengths | 9.30 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 35.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0028 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q19589 | 358-441 | IQAYSDTTMPDDDTISTRSWIWQTCTELGYYQTTDGGNGGIFGSTVPLDFFADQCIDLFGPEYTLDNTFKLVDQVRTKYGGADA |
| A0A0C2G3K0 | 7-86 | REEFDGQNFDSGARSWTWQTCTEFGYYQTTDGGPKGIFGDVTPLSVFVNMCTDVFGKKFDANYIDAAVRATLAHYGSAED |
| A0A821BIC2 | 132-215 | None |
| A0A7R9KJI0 | 528-609 | None |
| A0A7R9KE96 | 614-680 | None |
| A0A1J1J460 | 482-565 | None |
| A0A5F5XL98 | 254-340 | None |
| A0A3P6RJ41 | 3-87 | None |
| G0P4N4 | 263-349 | None |
| A0A3P7J8V1 | 45-141 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.