DPCstruct | MC9014
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 84 ± 7 aa |
| Standard deviation of domain lengths | 7.07 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 43.22 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0395 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2G035 | 1-80 | MFTLYDCGANPKKSTITTDVRQELAAVIYDTNVLGFKGPRKMHILIPGIYDINTYERKSIRPVAVSVTVEAKEHLLKVHI |
| A0A820USU7 | 6-87 | FTVFDQGSNPKKNVPIEQQRRELAAIAYETNILGFKGPRRMTIIIPGMSSDHHRVEVRPNDNSESLIERWKHNDMSNLLELH |
| A0A2A3EKL9 | 919-1002 | None |
| B7P1A7 | 106-184 | None |
| A0A2A6D368 | 276-356 | None |
| A0A2P6MXU3 | 325-406 | None |
| M7BP62 | 285-368 | None |
| A0A3L8S597 | 5-87 | None |
| A0A498MD98 | 442-523 | None |
| A0A5S6QFU7 | 162-257 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.