DPCstruct | MC9013
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.20 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 60.99 |
| Pfam Score | 95.45 |
| Assigned Pfam label(s) | PF09745- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7TKA1 | 19-86 | MHLRVENPPLSGRDHLAYRSFYAPCKFVVDGDLCEQYSTLDTGKQREIASALGLQPGVVVKKLEDLRT |
| A0A0C2FZ47 | 1-64 | MHVRANFPPLCGRDHLAFRSYYHPCKNVIDGDLCEQFGLMDAAAQREVTEGLDRTTSELAVSQD |
| A0A2S4UMM2 | 2-66 | None |
| A0A6F8ZSD0 | 901-967 | None |
| A0A6A6L6N5 | 1-70 | None |
| A0A4Z2HZ40 | 938-1004 | None |
| A0A2A6CCF2 | 152-210 | None |
| A0A4W5MA66 | 1-70 | None |
| N1RC15 | 82-144 | None |
| A0A7R9CPF2 | 630-696 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.