DPCstruct | MC9012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 144 ± 12 aa |
| Standard deviation of domain lengths | 12.26 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 85.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 31.85 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | CL0039- CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1N7SYW5 | 907-1045 | PIYYPQGKPVPQLQNDTALRRVCEVFRSVPNQKCTLENMPAVCEAAGLPMYWKMPVFLAITNDEDRLATQVDFTSWWKAMTSVAHDE… |
| A0A0C2FWX5 | 1-131 | MGLCNRAAAARVVLDTCSLADMPRLCEAANLPLYWKHPIFMSLTKGEPRRASLMDFTAWWRAMTSVAHDEAARFVYTLTGGNKSFLS… |
| A0A397V1N0 | 93-244 | None |
| A0A194PQU2 | 53-159 | None |
| A0A1X2GRV2 | 1-159 | None |
| A0A482WER8 | 106-257 | None |
| A0A822FGZ6 | 164-327 | None |
| A0A6A2Y9L6 | 104-248 | None |
| A0A3P7DRK7 | 21-165 | None |
| A0A4Z2CRU2 | 334-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.