DPCstruct | MC9011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 10.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 46.27 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0052 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2FRI9 | 2-94 | MVKKYGDWYSYDKTPRALIFRRDHENVVDMDSMIRLMRSNNYTQDPLSRCECDPPYSGENAISCRSDLNPPNGTYPFSALGHRDHGA… |
| A0A095CFR3 | 60-152 | MAKMHGDWYVHNMTSRAKIFRRDHHKVVDFPSMMLLMRYNDFMNDPLSACPCKPPYTSNKAISARDELNDPKGQYPIRSWSYRLHGG… |
| A0A5S6QFS7 | 328-441 | None |
| A0A6G0TWX0 | 953-1058 | None |
| A0A1L8HPY6 | 121-245 | None |
| W2SQN1 | 84-166 | None |
| A0A5A8DT28 | 1048-1152 | None |
| A0A812BAZ0 | 675-780 | None |
| A0A498M7Q3 | 740-825 | None |
| K1PTS9 | 82-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.