DPCstruct | MC9010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 48 ± 4 aa |
| Standard deviation of domain lengths | 4.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 86.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7E4UQG3 | 1-40 | DRITIEWTNTPDGAAKTFRREWFQGDGMVRRKNLPIEYNP |
| A0A0C2FQW2 | 9-57 | DYGREDTNNDRITVEWCNTPDGAAKQFRREWFQGDGMVRRKNLPIEYNP |
| A0A2A6BTX4 | 384-429 | None |
| A0A2A6BQH0 | 1-44 | None |
| A0A4X3P9G2 | 15-70 | None |
| A0A183FEW3 | 76-124 | None |
| A0A2H2IRX0 | 92-144 | None |
| A0A2G5TGN1 | 125-177 | None |
| A0A2A6CFW7 | 32-78 | None |
| A0A1I7XND0 | 79-123 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.