DPCstruct | MC9009
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 177 ± 31 aa |
| Standard deviation of domain lengths | 30.77 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 81.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0R3QVH3 | 3-170 | SNQCGLPPFVDDLPNSEKKEILSIWKDYKSGDDCTDQRRETQEIIDNLTSDIRAVLFGRPPSFLKDAPISVRKMFRDIMHNRTLKHD… |
| A0A0C2FPU1 | 1-161 | MLGKLLCTSLIVLAVSAQKSKIPCGLPPFVSKLPVKQAQQLNETWANYTNGSECAAEQKRTFEIIGSLTEAERDAVFETKEEPSSGL… |
| A0A0N5A8H8 | 15-178 | None |
| A0A2G5UC45 | 1-155 | None |
| A0A0N4W8S5 | 10-196 | None |
| A0A0M3IS17 | 132-295 | None |
| O76573 | 19-208 | None |
| A0A7E4VTR9 | 34-201 | None |
| A0A0K0E2G4 | 35-213 | None |
| A0A044TP39 | 1-283 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.