DPCstruct | MC9008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 261 ± 60 aa |
| Standard deviation of domain lengths | 59.74 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 18.57 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0094 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182T7Q2 | 4-256 | QTSKFGLGLLFNLTPLWNHDGDLVRAMNVSESVRMLRENIANNPKYLQNKVEYYFRNNKHRLTMTMSPDESYEKQFLDAEKKNLQQK… |
| A0A0C2FJM1 | 3-200 | KRPDMSLFFHMFGHHLYDDSVEHFSARVNEIAQEEAERLKQQREKLGIDGMRECGEKLCRAIEENSRKPDEELLKDLCVNELEEFNR… |
| A0A7R8CN83 | 248-544 | None |
| A0A6V7X3G8 | 133-336 | None |
| A0A1X7SQH9 | 1-173 | None |
| A0A545VLQ7 | 207-390 | None |
| A0A177W7I7 | 19-373 | None |
| A0A7R8X353 | 241-554 | None |
| A0A7C4T888 | 336-630 | None |
| A0A368F9Z1 | 6-265 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.