DPCstruct | MC9006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 102 ± 10 aa |
| Standard deviation of domain lengths | 9.91 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 90.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 35.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0635 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A162SBR5 | 443-548 | VRSLNLYREGDETHYNQRLEYCTLDRCWSECQALARTDQRRKEIDNFNRAHRFKKRGMALIPTKFGIAFTALFLNQAGALVHVYKDG… |
| A0A0C2FDB0 | 2-95 | NFYEEGGCTPFGMHLRQNNIARTWYECKEHSDYEHRLEQVREFNRVNKYRKRGIYMMPTRFGIGFGLKQLNQVLVAVWCPKKGVPQT… |
| A0A815RWV4 | 451-557 | None |
| A0A1R3HL87 | 325-444 | None |
| A0A0B1TJJ0 | 1-81 | None |
| A0A3N4J146 | 7-110 | None |
| A0A3N4IW25 | 482-594 | None |
| A0A446JWH8 | 906-1015 | None |
| A0A397EXJ0 | 9-100 | None |
| A0A6I9PRZ3 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.