DPCstruct | MC9005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 370 ± 43 aa |
| Standard deviation of domain lengths | 43.06 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 39.14 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6V7X284 | 144-539 | VDVPLICSYLAYWWQFGPEGPNRPSLPITQVSSEHINRFFCSLLRLMRDHIGREIAPWLCRAHSSAVPLIQFVSCDPVKDYLLPVAE… |
| A0A0C2FCH9 | 2-357 | VRNHVGIENAPWLCRTTFFAVQIIQNVTCDPVKEYILPIAERLRRMSEKAFREEEHMRTHPDDADEGTVAEDNARLVRDTYAYFPIL… |
| A0A5N4DIV1 | 239-568 | None |
| A0A6V7WTM0 | 151-601 | None |
| A0A4Z2AZD4 | 713-1072 | None |
| A0A437CCN1 | 235-599 | None |
| A0A0N5CMI5 | 1-290 | None |
| S7P8V3 | 72-498 | None |
| A0A2R7WGT7 | 81-442 | None |
| A0A1S3QHK8 | 49-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.