DPCstruct | MC9004
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 178 ± 28 aa |
| Standard deviation of domain lengths | 28.34 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 34.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| V4B9W1 | 128-286 | LFFIVFLSPGSTIIMLTVGLDVLIKVPFVIITPMVVALFVLYGVLCVQLSSQSQITLTKVFMLILGLSMICVVVGAAVFVVHDIITE… |
| A0A0C2F254 | 2-177 | VMLVSSILGPGTIFLMIVGAISISFNIDTNWSLLIVSVPVVTFCIVCLVAKPEKQLLFAQIVSALFAMLMTAVFVGTSLQIQKDGIL… |
| A0A1X7TXL3 | 57-277 | None |
| A0A7R9B6Z0 | 2-166 | None |
| K1PSH9 | 48-182 | None |
| A0A7R9DI64 | 2-167 | None |
| A0A8B6ETD5 | 40-268 | None |
| E2BA13 | 2-150 | None |
| A0A7R9Q9G1 | 839-1018 | None |
| A0A8B6CRP5 | 831-1056 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.