DPCstruct | MC9003
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 112 ± 16 aa |
| Standard deviation of domain lengths | 16.01 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 84.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 40.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C2F143 | 1-97 | MEESGSLGLAELLEKNKNAFLAGVDFVCISDSYWLGTTKPCLTHGLRGLATFKIEVTGIQQDLHSGVYGGVVHEPLQDLIWIMAQLT… |
| A0A0C2C6R5 | 2-115 | EESGSEGLEEALRHHKDTFLKGVDMTCISDNYWLGKNKPCLTYGLRGICYYFVEISCAKQDLHSGTYGGSIPEAMNDLIWVLSQLTE… |
| A0A1E4S3U7 | 1-97 | None |
| A0A388QWQ2 | 145-251 | None |
| A0A1B1UKK5 | 71-163 | None |
| A0A7J7IFV4 | 228-368 | None |
| A0A433DML5 | 211-317 | None |
| B4GBJ6 | 1-99 | None |
| A0A6P6C5N1 | 12-123 | None |
| A0A654H0C4 | 292-397 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.