DPCstruct | MC9002
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 159 ± 25 aa |
| Standard deviation of domain lengths | 25.22 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 77.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 39.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0205 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1I7Y3Y8 | 67-195 | QSGEKKAKPAFGVHDLPAEDIQKYKKPSWPQPFAQYAHCMDIPCSCSYYDGKVVNGSCILPSGKVLGKALRKDFRMYTPEEKRKFEE… |
| A0A0C2E240 | 17-176 | INACLLDSLNPGRQIVCDQIFNFNQVSLQISVPNLVSTALPRAIDGSGITMADAISGALPSDRNQCLSIECACGFIQGANYDGSRCN… |
| A0A0B1S158 | 1-117 | None |
| A0A3P7M3Y8 | 8-127 | None |
| A0A368G875 | 34-157 | None |
| A0A0R3QQ18 | 162-308 | None |
| A0A368FM62 | 216-380 | None |
| A0A0K0DWB1 | 30-246 | None |
| A0A2L0VDJ5 | 234-391 | None |
| A0A0J9YFM9 | 1-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.