DPCstruct | MC9000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 133 ± 15 aa |
| Standard deviation of domain lengths | 14.86 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 80.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 31.90 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A562HKK9 | 63-213 | FNLVEETARKTAVESGICTECPYTDKEERLKNGSVKLAEYNGVMLSCKLHHLFGYVFSTYRMAPESEQPLQRQFFYNKEAASQDFAI… |
| A0A644WIE1 | 18-161 | EYIGLLKDTPTLKASSLDALYKLLADFNGYVLGGMESSHGVQFTTWQWTYDKDGLTLGHYCGNDYTAAKHDFALRSRLVQEQKQFTP… |
| A0A1H0F0E9 | 217-347 | None |
| A0A1Y4LQI5 | 2-120 | None |
| A0A645HQD8 | 5-144 | None |
| A0A1Q6RXJ4 | 1-104 | None |
| A0A174WEQ8 | 76-184 | None |
| A0A645FTC8 | 29-158 | None |
| A0A318Y1G7 | 85-236 | None |
| V2YBE6 | 79-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.