DPCstruct | MC900
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 85 ± 21 aa |
| Standard deviation of domain lengths | 20.77 |
| Length coefficient of variation | 0.24 |
| Mean AlphaFold2 pLDDT confidence score | 81.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 22.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A150MR92 | 1-53 | MRKIHISHAKSGDVLAVDLFAANGSVLLSRGVRLTNGYIRSLAQKGVQYIYLN |
| A0A3P6KFL2 | 1-66 | MRLVPVKKLKEDSEIAINIIDSNGRLMLKEGQKITPKGVEILDNLGISYVYINDEYCFNNKQSKYT |
| A0A4R3K5W0 | 26-140 | None |
| A0A3A4PDD0 | 166-256 | None |
| W3AKV0 | 5-76 | None |
| B0THX9 | 2-95 | None |
| A0A520XDN6 | 1-111 | None |
| A0A5C8NSE8 | 1-52 | None |
| A0A101EW34 | 1-113 | None |
| A0A517U1U6 | 5-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.