DPCstruct | MC90
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 76 ± 6 aa |
| Standard deviation of domain lengths | 5.69 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.97 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.10 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y3V808 | 234-304 | STERVTVRVLLLFGDQAEIVADVPPEERAEPQRYPAAEIAAAVGVPVDQLAGKRLTAAVGDDDRLSGWQLA |
| A0A2W2E8K6 | 34-105 | DPSAPVECRVLLVVGEWAEVVTEHHGVGDDPLRVPAAGLADQLGVAVDALPGLRFSGVVGDDGLVTGVSLVS |
| A0A511MDN3 | 1-77 | None |
| A0A5R8P6F8 | 12-90 | None |
| A0A420V6I6 | 6-87 | None |
| A0A2W2GFU6 | 1-63 | None |
| A0A367FNG7 | 143-220 | None |
| A0A7W0CUV3 | 125-192 | None |
| A0A1Q4YK49 | 112-190 | None |
| A0A367ENP4 | 15-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.