DPCstruct | MC9
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 51 ± 5 aa |
| Standard deviation of domain lengths | 4.81 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 82.23 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0272- CL0016 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q174J8 | 1-49 | MHKYLEKENEVNFDKIFNQVLGYLLFRDFCDNVSDEPVPHLKFYEEVSS |
| A0A182R2B4 | 1-51 | MHKYLEKENEVNFDKIFNQVLGYLLFRDFCDNVSEEPVPHLKFYEEVSTIF |
| A0A182VPU7 | 1-41 | None |
| A0A162PCS8 | 38-92 | None |
| A0A182V7D5 | 10-63 | None |
| A0A182PLZ0 | 36-91 | None |
| A0A139WD85 | 44-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.