DPCstruct | MC8999
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 133 ± 25 aa |
| Standard deviation of domain lengths | 25.33 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 68.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.59 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644W1V9 | 1-138 | MGTQAVLEAVLHRVTLPLAAVMAFAPGTQIPLPEDALERLSLEGAGGRRLAPARLGQHRGFRALRLSSDEDEAALPQAVKPLKMTSA… |
| A0A1G3FK65 | 1-98 | MAVLGSLRLPLSAALSLRPGEILPLGAAAIEAVLMIGQDGRPIASGKLGQQRGVRAVRLADLAQKPLPPVTQPAQPNEPARNVTAIE… |
| A0A2R4M2P3 | 78-231 | None |
| A0A6N8A5A9 | 31-144 | None |
| A0A0N7LND0 | 55-166 | None |
| A0A7C5LWI9 | 123-299 | None |
| A0A7Z8LC21 | 381-521 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.