DPCstruct | MC8996
Metacluster Properties and Pfam Annotations
| Number of structural domains | 124 |
|---|---|
| Mean domain length (aa) | 248 ± 61 aa |
| Standard deviation of domain lengths | 61.33 |
| Length coefficient of variation | 0.25 |
| Mean AlphaFold2 pLDDT confidence score | 86.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 16.85 |
| Pfam Score | 56.65 |
| Assigned Pfam label(s) | PF08017- CL0020- PF20080 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484D8P5 | 6-232 | VSQMNESVMMQMGCLTQGFSNADLEKLPFLLDALEEIAHCGWNESQMKAVWKGVAKYNNLTVMHLKAEDIVALNQFICGLNSSEIRQ… |
| A0A420KDX9 | 210-463 | QGAQIAALSTDQIQALGTAQVASLETSQVKSLTAAQLGAMSTAQIAAIETQDLQQLSAAQLKSLGTAQIAALGTDQAGALSATQIKG… |
| A0A212S3E6 | 18-318 | None |
| A0A6L5CLR2 | 361-612 | None |
| A0A834PVH5 | 58-273 | None |
| A0A498LSQ5 | 50-365 | None |
| A0A1E7X6T7 | 130-411 | None |
| A0A5N9BWX7 | 238-694 | None |
| A0A7X6FSF1 | 20-157 | None |
| T1EYE3 | 878-1127 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.