DPCstruct | MC8995
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 367 ± 46 aa |
| Standard deviation of domain lengths | 45.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 70.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.35 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.56 |
| Pfam Score | 92.28 |
| Assigned Pfam label(s) | CL0409- PF03836 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| U6LAH0 | 5-397 | FASHYDMKEHFVTWASGDLLSLINICKKYEAYINLSAHDPIAKIVQAVSDGRDPPFSKQMVESAKAAKTSYTFRVEHRFLITERNLV… |
| A0A484D6Z1 | 54-407 | YSELLIVNKPVVYISVSELLNTHTLLLDHQEVLCPDPSNPLRLLLNDLGPAPTLQELTGESSSSADPGSEVSLTLTNKFDIFNESED… |
| Q5AH02 | 1243-1640 | None |
| A0A3M6UT71 | 325-649 | None |
| A0A444T2L8 | 124-518 | None |
| A0A812VVB8 | 148-582 | None |
| X6NQR8 | 170-574 | None |
| S4RYT1 | 257-622 | None |
| F2SE24 | 180-511 | None |
| A0A813H4N6 | 3-453 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.