DPCstruct | MC8994
Metacluster Properties and Pfam Annotations
| Number of structural domains | 46 |
|---|---|
| Mean domain length (aa) | 101 ± 17 aa |
| Standard deviation of domain lengths | 16.79 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 73.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 57.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A484DGC5 | 2-69 | QLLEENIVTFVKNELKKIQKVLSPDYPESQREDEDEEQRSSREAFLKITLHFLRKMKQDELADCLQSR |
| A0A484D5K8 | 15-110 | VPSGQSAQQHQTHLDSIFMLLEENIVTFVKNELKKIQKLLSPDYPECSESQRKDEDEEQRSSREAFLKITLHFLRRMKQDELADRLQ… |
| A0A484C3A4 | 40-153 | None |
| A0A484C389 | 91-193 | None |
| A0A484BY25 | 7-97 | None |
| A0A484BXV5 | 197-299 | None |
| A0A6P8TP30 | 215-327 | None |
| A0A437BZW9 | 10-97 | None |
| A0A484C3C7 | 2-83 | None |
| A0A6P6PGK2 | 5-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.