DPCstruct | MC8993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 112 ± 11 aa |
| Standard deviation of domain lengths | 10.83 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 50.18 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0526 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P8RRL7 | 89-198 | VVGVVEGTSCPCDQLVLMTCEDKNIYAYNGEELHLVASSLDKLFSDGIEFPASKTFYKGEAFKDVTKEDWAEVRKGPVGRKLDKEHQ… |
| A0A484D437 | 1-123 | MKVVGVVEETSCPYDHLVLMTCEDRKVYAFDGEEEELHMVAESLEKLGEEGLTFPSSQSYYKGEAFKDMTKEDWDKVRNSEEGKKLD… |
| A0A556U9G5 | 83-192 | None |
| A0A6J2QLX1 | 271-374 | None |
| A0A6J2QJW6 | 117-220 | None |
| A0A6A5F1R2 | 1-132 | None |
| A0A673XR71 | 83-215 | None |
| A0A3Q4N9Q0 | 56-164 | None |
| A0A1S3M498 | 83-189 | None |
| A0A6A5EAX2 | 275-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.