DPCstruct | MC8990
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 226 ± 23 aa |
| Standard deviation of domain lengths | 22.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 26.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y3U6L4 | 151-375 | YLYIEVADSLKFSAFMLSLRSVADQMMPDMIAWESQEKDGLEYVRITFADEDMPHLYYAVKSRALILSPREDVLFHAVQRLTARAGG… |
| A0A2D7WQR2 | 1-206 | MTVWSNHSHKGQGYVKIAPGKGLEDSLVKEGSAPIALYYVPTAKLLTVSLSEKMIQQVIDRSLLRRDNVTLPTANWGGMSTAFLASK… |
| A0A7Y4WJC7 | 464-705 | None |
| A0A7C8D622 | 17-245 | None |
| A0A7W1F467 | 235-436 | None |
| A0A5C9B1J1 | 86-361 | None |
| A0A7C8EI71 | 860-1068 | None |
| A0A351FED1 | 100-303 | None |
| A0A7X7QJB5 | 4-243 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.