DPCstruct | MC899
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 69 ± 5 aa |
| Standard deviation of domain lengths | 4.62 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.91 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 34.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3T1D356 | 20-86 | ITFDKLGRMNYHPDFHTNHKSRMSLDEIIYMCKYYEIDGPRTISFAIGRTEHTVMSKVYLLRKAGNF |
| A0A3P6K483 | 2-70 | APIEYDACGRMKYNPDLHKNNGTTWSEDDLNYLINWYEKIGIEEMSLALGKSEGTVAHKVQTLRKQGIM |
| A0A1I1B502 | 13-78 | None |
| A0A807ZC65 | 4-71 | None |
| A0A220MSK9 | 1-58 | None |
| A0A410MJ41 | 27-93 | None |
| A0A4R2K852 | 7-74 | None |
| A0A7X9XQM8 | 1-69 | None |
| A0A2D8A927 | 1-67 | None |
| A0A168R235 | 6-78 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.