DPCstruct | MC8989
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 200 ± 24 aa |
| Standard deviation of domain lengths | 23.83 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 75.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 30.74 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF05488 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L6QF48 | 1-216 | MAHAARLNDPIGHSPTMSWLLGGLLAAAAIAVAAVAIVGTGGLAAVAIVGGAAAAGAGLGEVMSTMSWAPKEVVGKIVGACSPTVFI… |
| A0A1W1V3T4 | 31-246 | VGAREVVEPAARVGDKIKHKSLLGAIAGAVVGGIVASAPYILVGFLGPFGAAARISMMLYDISQSLNTNTSQISEPSWAEQATEATS… |
| A0A7Y5KV44 | 4-229 | None |
| A0A419F4C9 | 8-180 | None |
| A0A1G7VRN6 | 5-205 | None |
| A0A1I2DU92 | 1-166 | None |
| A0A017T9G0 | 3-200 | None |
| A0A3C1DI64 | 92-271 | None |
| A0A850BUJ7 | 1-185 | None |
| A0A6M9CQ62 | 2-215 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.