DPCstruct | MC8988
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 111 ± 9 aa |
| Standard deviation of domain lengths | 8.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 82.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 21.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S0Z6Z6 | 24-124 | DITPQSAPVIPSTLQTEWEQLQSALRTRLTGEVTMTCHPHRIGHRGCVSLCFQGEQGRTDVLITVSGRAQFPQKEDYLSPRWYIDVA… |
| A0A1W1UNL4 | 5-126 | LFNTNIATGDIILNPKYRNKLEQLVTVIITVLKVDSGTSIQLNHWSYRVSPECVAHSLEFGNNCNENTYILTLTESKYISFNEFSFI… |
| A0A7S9LN12 | 70-184 | None |
| A0A3M5NJ40 | 221-329 | None |
| A0A811A6H4 | 6-111 | None |
| A0A0P9TZZ3 | 82-185 | None |
| A0A7Y4BI45 | 170-283 | None |
| A0A3N9FP72 | 7-127 | None |
| A0A2W1K0S6 | 1-108 | None |
| W0LG45 | 19-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.