DPCstruct | MC8987
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 128 ± 15 aa |
| Standard deviation of domain lengths | 14.72 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 90.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 24.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9UU47 | 8-154 | KIKYKMQYAKECNYIMINLVPPSGQADNLQGELLREIEKIRYEAQTNGNYNWDECFTFFCENIKTKLCEQKIFTDEEKNLIYEITDL… |
| A8FYC4 | 36-178 | ATHGRVQLTGCSQDIALWIWENLVPSSGRADTLQGEVIRAIELLAWEAQNNGNLNWDKEFDRLVDFLREVFTSSGSVIAATMNEEDK… |
| A0A7X6KT09 | 10-175 | None |
| A0A1P8YCU1 | 104-228 | None |
| A0A7Y4YN89 | 209-354 | None |
| A0A3S8RNV0 | 3-128 | None |
| A0A373CGU2 | 2-121 | None |
| A0A4V0IC55 | 120-240 | None |
| A0A7X9H4L8 | 1-98 | None |
| A0A848GU02 | 194-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.