DPCstruct | MC8986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 68 ± 3 aa |
| Standard deviation of domain lengths | 3.14 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 76.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 46.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D9LQ00 | 1-70 | MEPIDPIHLSESGLVVLDITGKDEETVQAAAAEVARRWATSGPPKVRRIPGEPGVRARLYADLRRSGTTR |
| A0A0N0N0A4 | 1-72 | MPGMRQINDARVAEPGLAVVEVAAADDQTAFALQEVLATRWATATADHTTRVPGEPGVLLRCHLDLRQELGT |
| A0A3N1P819 | 1-62 | None |
| A0A101Q905 | 9-74 | None |
| A0A7K3H2B3 | 3-71 | None |
| A0A0K8PSI5 | 48-117 | None |
| A0A286E3Z6 | 68-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.